MRPL39 Antikörper (N-Term)

Produktnummer ABIN630985

Produktdetails anti-MRPL39 Antikörper

Target: MRPL39 (Mitochondrial Ribosomal Protein L39 (MRPL39))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPL39 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MRPL39 antibody was raised against the N terminal of MRPL39

Aufreinigung: Affinity purified

Immunogen: MRPL39 antibody was raised using the N terminal of MRPL39 corresponding to a region with amino acids TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPL39 Blocking Peptide, catalog no. 33R-9047, is also available for use as a blocking control in assays to test for specificity of this MRPL39 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL39 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPL39

Target: MRPL39 (Mitochondrial Ribosomal Protein L39 (MRPL39))

Andere Bezeichnung: MRPL39 (MRPL39 Produkte)

Synonyme: CG17166 antikoerper, Dmel\\CG17166 antikoerper, MRP-L5 antikoerper, mRpL5 antikoerper, C21orf92 antikoerper, L39mt antikoerper, MRPL5 antikoerper, PRED22 antikoerper, PRED66 antikoerper, RPML5 antikoerper, C21orf8 antikoerper, ORF22 antikoerper, Rpml5 antikoerper, mitochondrial ribosomal protein L39 antikoerper, mitochondrial ribosomal protein L39 L homeolog antikoerper, mRpL39 antikoerper, mrpl39.L antikoerper, MRPL39 antikoerper, Mrpl39 antikoerper

Hintergrund: Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL39 is a 39S subunit protein. Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.

Molekulargewicht: 39 kDa (MW of target protein)