WBP11 Antikörper (N-Term)

Produktnummer ABIN630981

Dieses Anti-WBP11-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von WBP11 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für WBP11 Antikörper (N-Term) (ABIN630981)

Target: WBP11 (WW Domain Binding Protein 11 (WBP11))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WBP11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WBP11 Antikörper

Bindungsspezifität: N-Term

Spezifität: WBP11 antibody was raised against the N terminal of WBP11

Aufreinigung: Affinity purified

Immunogen: WBP11 antibody was raised using the N terminal of WBP11 corresponding to a region with amino acids GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WBP11 Blocking Peptide, (ABIN938927), is also available for use as a blocking control in assays to test for specificity of this WBP11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WBP11

Target: WBP11 (WW Domain Binding Protein 11 (WBP11))

Andere Bezeichnung: WBP11

Hintergrund: WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.

Molekulargewicht: 70 kDa (MW of target protein)