PRODH2 Antikörper

Produktnummer ABIN630971

Der Kaninchen Polyklonal Anti-PRODH2-Antikörper wurde für WB und IHC validiert. Er ist geeignet, PRODH2 in Proben von Human und Hund zu detektieren.

Kurzübersicht für PRODH2 Antikörper (ABIN630971)

Target: PRODH2 (Proline Dehydrogenase (Oxidase) 2 (PRODH2))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRODH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PRODH2 Antikörper

Aufreinigung: Affinity purified

Immunogen: PRODH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRODH2 Blocking Peptide, (ABIN940362), is also available for use as a blocking control in assays to test for specificity of this PRODH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRODH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRODH2

Target: PRODH2 (Proline Dehydrogenase (Oxidase) 2 (PRODH2))

Andere Bezeichnung: PRODH2

Hintergrund: PRODH2 is similar to proline dehydrogenase (oxidase) 1, a mitochondrial enzyme which catalyzes the first step in proline catabolism. The function of this protein has not been determined.

Molekulargewicht: 59 kDa (MW of target protein)