Adenylate Kinase 1 Antikörper (Middle Region)

Produktnummer ABIN630970

Produktdetails anti-Adenylate Kinase 1 Antikörper

Target: Adenylate Kinase 1 (AK1)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Adenylate Kinase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AK1 antibody was raised against the middle region of AK1

Aufreinigung: Affinity purified

Immunogen: AK1 antibody was raised using the middle region of AK1 corresponding to a region with amino acids RIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AK1 Blocking Peptide, catalog no. 33R-7966, is also available for use as a blocking control in assays to test for specificity of this AK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Adenylate Kinase 1

Target: Adenylate Kinase 1 (AK1)

Andere Bezeichnung: AK1 (AK1 Produkte)

Synonyme: ADK-1 antikoerper, AK1 antikoerper, CG17146 antikoerper, DAK1 antikoerper, Dak1 antikoerper, Dmel\\CG17146 antikoerper, adk1 antikoerper, bs34e10.y1 antikoerper, ak5 antikoerper, ADENYLATE KINASE 1 antikoerper, MLE2.3 antikoerper, MLE2_3 antikoerper, adenylate kinase 1 antikoerper, Ak-1 antikoerper, B430205N08Rik antikoerper, Ak 1 antikoerper, zgc:91930 antikoerper, Myokinase antikoerper, Adenylate kinase 1 antikoerper, adenylate kinase 1 antikoerper, Adk1 antikoerper, ak1 antikoerper, AK1 antikoerper, ADK1 antikoerper, Ak1 antikoerper

Hintergrund: Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process