DPPA2 Antikörper (N-Term)

Produktnummer ABIN630962

Der Kaninchen Polyklonal anti-DPPA2 Antikörper wird verwendet zum Nachweis von DPPA2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für DPPA2 Antikörper (N-Term) (ABIN630962)

Target: DPPA2 (Developmental Pluripotency Associated 2 (DPPA2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPPA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DPPA2 Antikörper

Bindungsspezifität: N-Term

Spezifität: DPPA2 antibody was raised against the N terminal of DPPA2

Aufreinigung: Affinity purified

Immunogen: DPPA2 antibody was raised using the N terminal of DPPA2 corresponding to a region with amino acids NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPPA2 Blocking Peptide, (ABIN5613250), is also available for use as a blocking control in assays to test for specificity of this DPPA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPPA2

Target: DPPA2 (Developmental Pluripotency Associated 2 (DPPA2))

Andere Bezeichnung: DPPA2

Hintergrund: DPPA2 may play a role in maintaining cell pluripotentiality. ECSA/DPPA2 is a promising target for antigen-specific immunotherapy in non-small cell lung cancers.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Stem Cell Maintenance