HMGCS1 Antikörper

Produktnummer ABIN630954

Der Kaninchen Polyklonal anti-HMGCS1 Antikörper (ABIN630954) detektiert spezifisch HMGCS1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für HMGCS1 Antikörper (ABIN630954)

Target: HMGCS1 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 1 (Soluble) (HMGCS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGCS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HMGCS1 Antikörper

Aufreinigung: Affinity purified

Immunogen: HMGCS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HMGCS1 Blocking Peptide, (ABIN939672), is also available for use as a blocking control in assays to test for specificity of this HMGCS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HMGCS1

Target: HMGCS1 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 1 (Soluble) (HMGCS1))

Andere Bezeichnung: HMGCS1

Hintergrund: This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha