HMGCS1 Antikörper

Produktnummer ABIN630954

Produktdetails anti-HMGCS1 Antikörper

Target: HMGCS1 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 1 (Soluble) (HMGCS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGCS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HMGCS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HMGCS1 Blocking Peptide, catalog no. 33R-4286, is also available for use as a blocking control in assays to test for specificity of this HMGCS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HMGCS1

Target: HMGCS1 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 1 (Soluble) (HMGCS1))

Andere Bezeichnung: HMGCS1 (HMGCS1 Produkte)

Synonyme: HMGCS antikoerper, zgc:56481 antikoerper, B130032C06Rik antikoerper, 3-hydroxy-3-methylglutaryl-CoA synthase 1 antikoerper, 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) antikoerper, 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 antikoerper, 3-hydroxy-3-methylglutaryl coenzyme A synthase antikoerper, hydroxymethylglutaryl-CoA synthase antikoerper, 3-hydroxy-3-methylglutaryl-CoA synthase antikoerper, hydroxymethylglutaryl coenzyme A synthase antikoerper, 3-hydroxy-3-methylglutaryl-CoA synthase 1 S homeolog antikoerper, HMGCS1 antikoerper, hmgcs1 antikoerper, Hmgcs1 antikoerper, mvaS antikoerper, SAS2432 antikoerper, SZO_RS04705 antikoerper, SEQ_1109 antikoerper, NAEGRDRAFT_77778 antikoerper, hmgcs1.S antikoerper

Hintergrund: This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha