ADH4 Antikörper

Produktnummer ABIN630951

Dieser Anti-ADH4 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von ADH4 in WB. Geeignet für Human.

Kurzübersicht für ADH4 Antikörper (ABIN630951)

Target: ADH4 (Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADH4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADH4 Antikörper

Aufreinigung: Affinity purified

Immunogen: ADH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADH4 Blocking Peptide, (ABIN5611951), is also available for use as a blocking control in assays to test for specificity of this ADH4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADH4

Target: ADH4 (Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4))

Andere Bezeichnung: ADH4

Hintergrund: ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis