FKBP5 Antikörper (C-Term)

Produktnummer ABIN630950

Produktdetails anti-FKBP5 Antikörper

Target: FKBP5 (FK506 Binding Protein 5 (FKBP5))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FKBP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FKBP5 antibody was raised against the C terminal of FKBP5

Aufreinigung: Affinity purified

Immunogen: FKBP5 antibody was raised using the C terminal of FKBP5 corresponding to a region with amino acids CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FKBP5 Blocking Peptide, catalog no. 33R-1834, is also available for use as a blocking control in assays to test for specificity of this FKBP5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FKBP5

Target: FKBP5 (FK506 Binding Protein 5 (FKBP5))

Andere Bezeichnung: FKBP5 (FKBP5 Produkte)

Synonyme: FKBP5 antikoerper, FKBP-5 antikoerper, AIG6 antikoerper, FKBP51 antikoerper, FKBP54 antikoerper, P54 antikoerper, PPIase antikoerper, Ptg-10 antikoerper, D17Ertd592e antikoerper, Dit1 antikoerper, si:zc263a23.8 antikoerper, wu:fc31g11 antikoerper, wu:fl87b03 antikoerper, zgc:64082 antikoerper, FK506 binding protein 5 antikoerper, FKBP5 antikoerper, fkbp5 antikoerper, Fkbp5 antikoerper

Hintergrund: FKBP5 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. It is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein.

Molekulargewicht: 51 kDa (MW of target protein)