FBLN3 Antikörper (Middle Region)

Produktnummer ABIN630948

Der Kaninchen Polyklonal anti-FBLN3 Antikörper (ABIN630948) detektiert spezifisch FBLN3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für FBLN3 Antikörper (Middle Region) (ABIN630948)

Target: FBLN3 (Fibulin 3 (FBLN3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBLN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FBLN3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: EFEMP1 antibody was raised against the middle region of EFEMP1

Aufreinigung: Affinity purified

Immunogen: EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EFEMP1 Blocking Peptide, (ABIN5613311), is also available for use as a blocking control in assays to test for specificity of this EFEMP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBLN3

Target: FBLN3 (Fibulin 3 (FBLN3))

Andere Bezeichnung: EFEMP1

Hintergrund: EFEMP1 genepans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway