LASP1 Antikörper (C-Term)

Produktnummer ABIN630939

Dieses Anti-LASP1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von LASP1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für LASP1 Antikörper (C-Term) (ABIN630939)

Target: LASP1 (LIM and SH3 Protein 1 (LASP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LASP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LASP1 Antikörper

Bindungsspezifität: C-Term

Spezifität: LASP1 antibody was raised against the C terminal of LASP1

Aufreinigung: Affinity purified

Immunogen: LASP1 antibody was raised using the C terminal of LASP1 corresponding to a region with amino acids SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LASP1 Blocking Peptide, (ABIN5614419), is also available for use as a blocking control in assays to test for specificity of this LASP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LASP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LASP1

Target: LASP1 (LIM and SH3 Protein 1 (LASP1))

Andere Bezeichnung: LASP1

Hintergrund: LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.

Molekulargewicht: 30 kDa (MW of target protein)