GARS Antikörper (Middle Region)
-
- Target Alle GARS Antikörper anzeigen
- GARS (Glycyl-tRNA Synthetase (GARS))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GARS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GARS antibody was raised against the middle region of GARS
- Aufreinigung
- Affinity purified
- Immunogen
- GARS antibody was raised using the middle region of GARS corresponding to a region with amino acids IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN
- Top Product
- Discover our top product GARS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GARS Blocking Peptide, catalog no. 33R-3949, is also available for use as a blocking control in assays to test for specificity of this GARS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GARS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GARS (Glycyl-tRNA Synthetase (GARS))
- Andere Bezeichnung
- GARS (GARS Produkte)
- Hintergrund
- GARS catalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs.
- Molekulargewicht
- 83 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-