PEX5 Antikörper (Middle Region)

Produktnummer ABIN630928

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PEX5 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für PEX5 Antikörper (Middle Region) (ABIN630928)

Target: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEX5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PEX5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PEX5 antibody was raised against the middle region of PEX5

Aufreinigung: Affinity purified

Immunogen: PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PEX5 Blocking Peptide, (ABIN5615318), is also available for use as a blocking control in assays to test for specificity of this PEX5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEX5

Target: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Andere Bezeichnung: PEX5

Hintergrund: PEX5 binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process