PSMB2 Antikörper

Produktnummer ABIN630919

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PSMB2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für PSMB2 Antikörper (ABIN630919)

Target: PSMB2 (Proteasome (Prosome, Macropain) Subunit, beta Type 2 (PSMB2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PSMB2 Antikörper

Aufreinigung: Affinity purified

Immunogen: PSMB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSMB2 Blocking Peptide, (ABIN936022), is also available for use as a blocking control in assays to test for specificity of this PSMB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMB2

Target: PSMB2 (Proteasome (Prosome, Macropain) Subunit, beta Type 2 (PSMB2))

Andere Bezeichnung: PSMB2

Hintergrund: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB2 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA