PEX5 Antikörper (N-Term)

Produktnummer ABIN630915

Dieses Anti-PEX5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PEX5 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für PEX5 Antikörper (N-Term) (ABIN630915)

Target: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEX5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PEX5 Antikörper

Bindungsspezifität: N-Term

Spezifität: PEX5 antibody was raised against the N terminal of PEX5

Aufreinigung: Affinity purified

Immunogen: PEX5 antibody was raised using the N terminal of PEX5 corresponding to a region with amino acids TATDRWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PEX5 Blocking Peptide, (ABIN5615319), is also available for use as a blocking control in assays to test for specificity of this PEX5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEX5

Target: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Andere Bezeichnung: PEX5

Hintergrund: PEX5 binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process