ALDOC Antikörper (N-Term)

Produktnummer ABIN630907

Produktdetails anti-ALDOC Antikörper

Target: ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDOC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ALDOC antibody was raised against the N terminal of ALDOC

Aufreinigung: Affinity purified

Immunogen: ALDOC antibody was raised using the N terminal of ALDOC corresponding to a region with amino acids MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDOC Blocking Peptide, catalog no. 33R-6286, is also available for use as a blocking control in assays to test for specificity of this ALDOC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALDOC

Target: ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))

Andere Bezeichnung: ALDOC (ALDOC Produkte)

Synonyme: ALDC antikoerper, MGC69434 antikoerper, ALDOC antikoerper, aldoc antikoerper, AI847350 antikoerper, AU040929 antikoerper, Aldo3 antikoerper, Scrg2 antikoerper, ALDCAA antikoerper, F16dip7 antikoerper, RATALDCAA antikoerper, aldocl antikoerper, wu:fj56h04 antikoerper, zgc:112357 antikoerper, QccE-21970 antikoerper, aldolase, fructose-bisphosphate C antikoerper, aldolase, fructose-bisphosphate C L homeolog antikoerper, aldolase C, fructose-bisphosphate, b antikoerper, aldolase C, fructose-bisphosphate antikoerper, aldolase A, fructose-bisphosphate antikoerper, aldolase C, fructose-bisphosphate, a antikoerper, Fructose-bisphosphate aldolase C antikoerper, ALDOC antikoerper, aldoc.L antikoerper, aldoc antikoerper, aldocb antikoerper, Aldoc antikoerper, ALDOA antikoerper, aldoca antikoerper

Hintergrund: ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.

Molekulargewicht: 39 kDa (MW of target protein)