GAMT Antikörper (Middle Region)

Produktnummer ABIN630904

Produktdetails anti-GAMT Antikörper

Target: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAMT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GAMT antibody was raised against the middle region of GAMT

Aufreinigung: Affinity purified

Immunogen: GAMT antibody was raised using the middle region of GAMT corresponding to a region with amino acids PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAMT Blocking Peptide, catalog no. 33R-7098, is also available for use as a blocking control in assays to test for specificity of this GAMT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAMT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GAMT

Target: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Andere Bezeichnung: GAMT (GAMT Produkte)

Synonyme: gamt antikoerper, zgc:123136 antikoerper, CCDS2 antikoerper, PIG2 antikoerper, TP53I2 antikoerper, AA571402 antikoerper, Spintz1 antikoerper, MGC75698 antikoerper, GAMT antikoerper, GMT antikoerper, guanidinoacetate N-methyltransferase L homeolog antikoerper, guanidinoacetate N-methyltransferase S homeolog antikoerper, guanidinoacetate N-methyltransferase antikoerper, guanidinoacetate methyltransferase antikoerper, gamt.L antikoerper, gamt.S antikoerper, gamt antikoerper, GAMT antikoerper, Gamt antikoerper

Hintergrund: GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia.

Molekulargewicht: 29 kDa (MW of target protein)