MBP Antikörper (Middle Region)
-
- Target Alle MBP Antikörper anzeigen
- MBP (Myelin Basic Protein (MBP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MBP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MBP antibody was raised against the middle region of MBP
- Aufreinigung
- Affinity purified
- Immunogen
- MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV
- Top Product
- Discover our top product MBP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MBP Blocking Peptide, catalog no. 33R-2903, is also available for use as a blocking control in assays to test for specificity of this MBP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MBP (Myelin Basic Protein (MBP))
- Andere Bezeichnung
- Myelin basic protein (MBP Produkte)
- Hintergrund
- The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells.
- Molekulargewicht
- 33 kDa (MW of target protein)
-