MBP Antikörper (Middle Region)

Produktnummer ABIN630897

Dieses Anti-MBP-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MBP in WB. Geeignet für Human und Ratte.

Kurzübersicht für MBP Antikörper (Middle Region) (ABIN630897)

Target: MBP (Myelin Basic Protein (MBP))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MBP Antikörper

Bindungsspezifität: Middle Region

Spezifität: MBP antibody was raised against the middle region of MBP

Aufreinigung: Affinity purified

Immunogen: MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MBP Blocking Peptide, (ABIN938331), is also available for use as a blocking control in assays to test for specificity of this MBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MBP

Target: MBP (Myelin Basic Protein (MBP))

Andere Bezeichnung: Myelin basic protein

Hintergrund: The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells.

Molekulargewicht: 33 kDa (MW of target protein)