PGK2 Antikörper (C-Term)
Kurzübersicht für PGK2 Antikörper (C-Term) (ABIN630896)
Target
Alle PGK2 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- PGK2 antibody was raised against the C terminal of PGK2
-
Aufreinigung
- Affinity purified
-
Immunogen
- PGK2 antibody was raised using the C terminal of PGK2 corresponding to a region with amino acids ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
PGK2 Blocking Peptide, (ABIN939575), is also available for use as a blocking control in assays to test for specificity of this PGK2 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGK2 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- PGK2 (Phosphoglycerate Kinase 2 (PGK2))
-
Andere Bezeichnung
- PGK2
-
Hintergrund
- PGK2 is a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP.
-
Molekulargewicht
- 46 kDa (MW of target protein)
Target
-