SCO1 Antikörper
-
- Target Alle SCO1 Antikörper anzeigen
- SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SCO1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL
- Top Product
- Discover our top product SCO1 Primärantikörper
-
anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) (AA 1-301) antibody
SCO1 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) (AA 1-160) antibodySCO1 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) (AA 125-158) antibodySCO1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB48404 unconjugated
anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) (AA 29-176) antibodySCO1 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) (AA 202-301) antibodySCO1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) (AA 107-156) antibodySCO1 Reaktivität: Human, Ratte, Maus, Rind (Kuh), Pferd, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) (Center) antibodySCO1 Reaktivität: Human, Ratte, Maus WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SCO1 Blocking Peptide, catalog no. 33R-1346, is also available for use as a blocking control in assays to test for specificity of this SCO1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCO1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))
- Andere Bezeichnung
- SCO1 (SCO1 Produkte)
- Synonyme
- SCOD1 antikoerper, 2610001C07Rik antikoerper, D11Bwg1310e antikoerper, SCO1 antikoerper, RGD1559538 antikoerper, SCO1, cytochrome c oxidase assembly protein antikoerper, SCO1 cytochrome c oxidase assembly protein antikoerper, SCO1 antikoerper, Sco1 antikoerper, sco1 antikoerper
- Hintergrund
- Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Transition Metal Ion Homeostasis, Stem Cell Maintenance, Production of Molecular Mediator of Immune Response, Regulation of long-term Neuronal Synaptic Plasticity
-
