SCO1 Antikörper

Produktnummer ABIN630894

Dieses Anti-SCO1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SCO1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für SCO1 Antikörper (ABIN630894)

Target: SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SCO1 Antikörper

Aufreinigung: Affinity purified

Immunogen: SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCO1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SCO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCO1

Target: SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))

Andere Bezeichnung: SCO1

Hintergrund: Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Stem Cell Maintenance, Production of Molecular Mediator of Immune Response, Regulation of long-term Neuronal Synaptic Plasticity