TIMM44 Antikörper

Produktnummer ABIN630889

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TIMM44 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für TIMM44 Antikörper (ABIN630889)

Target: TIMM44 (Translocase of Inner Mitochondrial Membrane 44 (TIMM44))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TIMM44 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TIMM44 Antikörper

Aufreinigung: Affinity purified

Immunogen: TIMM44 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TIMM44 Blocking Peptide, (ABIN5616607), is also available for use as a blocking control in assays to test for specificity of this TIMM44 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIMM44 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TIMM44

Target: TIMM44 (Translocase of Inner Mitochondrial Membrane 44 (TIMM44))

Andere Bezeichnung: TIMM44

Hintergrund: TIMM44 is the essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.

Molekulargewicht: 51 kDa (MW of target protein)