MEMO1 Antikörper (Middle Region)

Produktnummer ABIN630881

Der Kaninchen Polyklonal anti-MEMO1 Antikörper wird verwendet zum Nachweis von MEMO1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für MEMO1 Antikörper (Middle Region) (ABIN630881)

Target: MEMO1 (Mediator of Cell Motility 1 (MEMO1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MEMO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MEMO1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MEMO1 antibody was raised against the middle region of MEMO1

Aufreinigung: Affinity purified

Immunogen: MEMO1 antibody was raised using the middle region of MEMO1 corresponding to a region with amino acids AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MEMO1 Blocking Peptide, (ABIN936772), is also available for use as a blocking control in assays to test for specificity of this MEMO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MEMO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MEMO1

Target: MEMO1 (Mediator of Cell Motility 1 (MEMO1))

Andere Bezeichnung: MEMO1

Hintergrund: MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.

Molekulargewicht: 34 kDa (MW of target protein)