PECI/ECI2 Antikörper (Middle Region)

Produktnummer ABIN630872

Produktdetails anti-PECI/ECI2 Antikörper

Target: PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PECI/ECI2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PECI antibody was raised against the middle region of PECI

Aufreinigung: Affinity purified

Immunogen: PECI antibody was raised using the middle region of PECI corresponding to a region with amino acids AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PECI Blocking Peptide, catalog no. 33R-1595, is also available for use as a blocking control in assays to test for specificity of this PECI antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PECI antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PECI/ECI2

Target: PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))

Andere Bezeichnung: PECI (PECI Produkte)

Synonyme: PECI antikoerper, ACBD2 antikoerper, DRS-1 antikoerper, DRS1 antikoerper, HCA88 antikoerper, dJ1013A10.3 antikoerper, Peci antikoerper, Acbd2 antikoerper, Drs1 antikoerper, Hca88 antikoerper, ECI2 antikoerper, wu:fd61c12 antikoerper, enoyl-CoA delta isomerase 2 antikoerper, enoyl-Coenzyme A delta isomerase 2 antikoerper, peroxisomal D3,D2-enoyl-CoA isomerase antikoerper, ECI2 antikoerper, Eci2 antikoerper, peci antikoerper, eci2 antikoerper

Hintergrund: PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.

Molekulargewicht: 40 kDa (MW of target protein)