PECI/ECI2 Antikörper (Middle Region)

Produktnummer ABIN630872

Der Kaninchen Polyklonal Anti-PECI/ECI2-Antikörper wurde für WB validiert. Er ist geeignet, PECI/ECI2 in Proben von Human und Ratte zu detektieren.

Kurzübersicht für PECI/ECI2 Antikörper (Middle Region) (ABIN630872)

Target: PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PECI/ECI2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PECI/ECI2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PECI antibody was raised against the middle region of PECI

Aufreinigung: Affinity purified

Immunogen: PECI antibody was raised using the middle region of PECI corresponding to a region with amino acids AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PECI Blocking Peptide, (ABIN936981), is also available for use as a blocking control in assays to test for specificity of this PECI antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PECI antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PECI/ECI2

Target: PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))

Andere Bezeichnung: PECI

Hintergrund: PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.

Molekulargewicht: 40 kDa (MW of target protein)