PHACTR3 Antikörper (C-Term)

Produktnummer ABIN630871

Produktdetails anti-PHACTR3 Antikörper

Target: PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PHACTR3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PHACTR3 antibody was raised against the C terminal of PHACTR3

Aufreinigung: Affinity purified

Immunogen: PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PHACTR3 Blocking Peptide, catalog no. 33R-3947, is also available for use as a blocking control in assays to test for specificity of this PHACTR3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACTR3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PHACTR3

Target: PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))

Andere Bezeichnung: PHACTR3 (PHACTR3 Produkte)

Synonyme: C20orf101 antikoerper, H17739 antikoerper, SCAPIN1 antikoerper, SCAPININ antikoerper, 1500003N10Rik antikoerper, 4930415A02Rik antikoerper, Scapin1 antikoerper, Scapinin antikoerper, mKIAA4224 antikoerper, scapinin antikoerper, h17739 antikoerper, scapin1 antikoerper, DKFZp459A1919 antikoerper, zgc:109967 antikoerper, zgc:172129 antikoerper, phosphatase and actin regulator 3 antikoerper, phosphatase and actin regulator 3 L homeolog antikoerper, phosphatase and actin regulator 3b antikoerper, phosphatase and actin regulator 3a antikoerper, PHACTR3 antikoerper, Phactr3 antikoerper, phactr3.L antikoerper, phactr3 antikoerper, LOC100543179 antikoerper, phactr3b antikoerper, phactr3a antikoerper

Hintergrund: PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.

Molekulargewicht: 51 kDa (MW of target protein)