PHACTR3 Antikörper (C-Term)
Kurzübersicht für PHACTR3 Antikörper (C-Term) (ABIN630871)
Target
Alle PHACTR3 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- PHACTR3 antibody was raised against the C terminal of PHACTR3
-
Aufreinigung
- Affinity purified
-
Immunogen
- PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
PHACTR3 Blocking Peptide, (ABIN939333), is also available for use as a blocking control in assays to test for specificity of this PHACTR3 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACTR3 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))
-
Andere Bezeichnung
- PHACTR3
-
Hintergrund
- PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.
-
Molekulargewicht
- 51 kDa (MW of target protein)
Target
-