NEK11 Antikörper

Produktnummer ABIN630865

Produktdetails anti-NEK11 Antikörper

Target: NEK11 (NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEK11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NEK11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NEK11 Blocking Peptide, catalog no. 33R-4339, is also available for use as a blocking control in assays to test for specificity of this NEK11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NEK11

Target: NEK11 (NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11))

Andere Bezeichnung: NEK11 (NEK11 Produkte)

Synonyme: nek11 antikoerper, MGC147549 antikoerper, 4932416N14Rik antikoerper, NIMA-related kinase 11 antikoerper, NIMA (never in mitosis gene a)-related expressed kinase 11 antikoerper, NIMA related kinase 11 antikoerper, nek11 antikoerper, Nek11 antikoerper, NEK11 antikoerper

Hintergrund: NEK11 is a member of the never in mitosis gene A family of kinases. NEK11 localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. It appears to play roles in DNA replication and response to genotoxic stress. NEK11 belongs to the NIMA family of kinases, which are involved in DNA replication and genotoxic stress responses.

Molekulargewicht: 74 kDa (MW of target protein)