TNKS1BP1 Antikörper (Middle Region)

Produktnummer ABIN630864

Produktdetails anti-TNKS1BP1 Antikörper

Target: TNKS1BP1 (Tankyrase 1 Binding Protein 1, 182kDa (TNKS1BP1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNKS1BP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TNKS1 BP1 antibody was raised against the middle region of TNKS1 P1

Aufreinigung: Affinity purified

Immunogen: TNKS1 BP1 antibody was raised using the middle region of TNKS1 P1 corresponding to a region with amino acids DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TNKS1BP1 Blocking Peptide, catalog no. 33R-1945, is also available for use as a blocking control in assays to test for specificity of this TNKS1BP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNKS0 P1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNKS1BP1

Target: TNKS1BP1 (Tankyrase 1 Binding Protein 1, 182kDa (TNKS1BP1))

Andere Bezeichnung: TNKS1BP1 (TNKS1BP1 Produkte)

Synonyme: TAB182 antikoerper, Tab182 antikoerper, mKIAA1741 antikoerper, tankyrase 1 binding protein 1 antikoerper, 182 kDa tankyrase-1-binding protein antikoerper, TNKS1BP1 antikoerper, LOC100625088 antikoerper, Tnks1bp1 antikoerper

Hintergrund: TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.

Molekulargewicht: 190 kDa (MW of target protein)