HSPA4 Antikörper (Middle Region)

Produktnummer ABIN630854

Produktdetails anti-HSPA4 Antikörper

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HSPA4 antibody was raised against the middle region of HSPA4

Aufreinigung: Affinity purified

Immunogen: HSPA4 antibody was raised using the middle region of HSPA4 corresponding to a region with amino acids PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPA4 Blocking Peptide, catalog no. 33R-7155, is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPA4

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Andere Bezeichnung: HSPA4 (HSPA4 Produkte)

Synonyme: APG-2 antikoerper, HS24/P52 antikoerper, HSPH2 antikoerper, RY antikoerper, hsp70 antikoerper, hsp70RY antikoerper, Hsp110 antikoerper, Hsp70 antikoerper, irp94 antikoerper, 70kDa antikoerper, AI317151 antikoerper, Hsp70RY antikoerper, mKIAA4025 antikoerper, hspa4 antikoerper, wu:fi30e11 antikoerper, zgc:55743 antikoerper, zgc:77413 antikoerper, hs24/p52 antikoerper, hspa4-a antikoerper, osp94 antikoerper, pg-2 antikoerper, hspa4l antikoerper, wu:fc41d05 antikoerper, wu:fi59h02 antikoerper, wu:fj35c08 antikoerper, zgc:55506 antikoerper, heat shock protein family A (Hsp70) member 4 antikoerper, heat shock protein family A member 4 antikoerper, heat shock protein 4 antikoerper, heat shock protein 4b antikoerper, heat shock protein family A (Hsp70) member 4 S homeolog antikoerper, heat shock protein 4a antikoerper, HSPA4 antikoerper, Hspa4 antikoerper, hspa4b antikoerper, hspa4.S antikoerper, hspa4a antikoerper

Hintergrund: HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.

Molekulargewicht: 94 kDa (MW of target protein)