HSPA4 Antikörper (Middle Region)

Produktnummer ABIN630854

Der Kaninchen Polyklonal Anti-HSPA4-Antikörper wurde für WB validiert. Er ist geeignet, HSPA4 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für HSPA4 Antikörper (Middle Region) (ABIN630854)

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HSPA4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: HSPA4 antibody was raised against the middle region of HSPA4

Aufreinigung: Affinity purified

Immunogen: HSPA4 antibody was raised using the middle region of HSPA4 corresponding to a region with amino acids PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPA4 Blocking Peptide, (ABIN5614099), is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPA4

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Andere Bezeichnung: HSPA4

Hintergrund: HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.

Molekulargewicht: 94 kDa (MW of target protein)