GC-Rich Promoter Binding Protein 1 (GPBP1) (N-Term) Antikörper
-
- Target Alle GC-Rich Promoter Binding Protein 1 (GPBP1) Antikörper anzeigen
- GC-Rich Promoter Binding Protein 1 (GPBP1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- DKFZP761 C169 antibody was raised against the N terminal Of Dkfzp761 169
- Aufreinigung
- Affinity purified
- Immunogen
- DKFZP761 C169 antibody was raised using the N terminal Of Dkfzp761 169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DKFZP761C169 Blocking Peptide, catalog no. 33R-7991, is also available for use as a blocking control in assays to test for specificity of this DKFZP761C169 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKFZP760 169 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GC-Rich Promoter Binding Protein 1 (GPBP1)
- Abstract
- GPBP1 Produkte
- Hintergrund
- Vasculin is a novel vascular protein differentially expressed in human atherogenesis.
- Molekulargewicht
- 52 kDa (MW of target protein)
-