GC-Rich Promoter Binding Protein 1 (GPBP1) (N-Term) Antikörper

Produktnummer ABIN630853

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für GC-Rich Promoter Binding Protein 1 (GPBP1) (N-Term) Antikörper (ABIN630853)

Target: GC-Rich Promoter Binding Protein 1 (GPBP1)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: DKFZP761 C169 antibody was raised against the N terminal Of Dkfzp761 169

Aufreinigung: Affinity purified

Immunogen: DKFZP761 C169 antibody was raised using the N terminal Of Dkfzp761 169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DKFZP761C169 Blocking Peptide, (ABIN5613207), is also available for use as a blocking control in assays to test for specificity of this DKFZP761C169 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKFZP760 169 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: GC-Rich Promoter Binding Protein 1 (GPBP1)

Hintergrund: Vasculin is a novel vascular protein differentially expressed in human atherogenesis.

Molekulargewicht: 52 kDa (MW of target protein)