GC-Rich Promoter Binding Protein 1 (GPBP1) (N-Term) Antikörper
Kurzübersicht für GC-Rich Promoter Binding Protein 1 (GPBP1) (N-Term) Antikörper (ABIN630853)
Target
Alle GC-Rich Promoter Binding Protein 1 (GPBP1) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- DKFZP761 C169 antibody was raised against the N terminal Of Dkfzp761 169
-
Aufreinigung
- Affinity purified
-
Immunogen
- DKFZP761 C169 antibody was raised using the N terminal Of Dkfzp761 169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP
-
-
-
-
Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
DKFZP761C169 Blocking Peptide, (ABIN5613207), is also available for use as a blocking control in assays to test for specificity of this DKFZP761C169 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKFZP760 169 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- GC-Rich Promoter Binding Protein 1 (GPBP1)
-
Hintergrund
- Vasculin is a novel vascular protein differentially expressed in human atherogenesis.
-
Molekulargewicht
- 52 kDa (MW of target protein)
Target
-