SPNS2 Antikörper

Produktnummer ABIN630851

Der Kaninchen Polyklonal Anti-SPNS2-Antikörper wurde für WB validiert. Er ist geeignet, SPNS2 in Proben von Human zu detektieren.

Kurzübersicht für SPNS2 Antikörper (ABIN630851)

Target: SPNS2 (Spinster Homolog 2 (SPNS2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPNS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SPNS2 Antikörper

Aufreinigung: Affinity purified

Immunogen: SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPNS2 Blocking Peptide, (ABIN5616374), is also available for use as a blocking control in assays to test for specificity of this SPNS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPNS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPNS2

Target: SPNS2 (Spinster Homolog 2 (SPNS2))

Andere Bezeichnung: SPNS2

Hintergrund: SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.

Molekulargewicht: 60 kDa (MW of target protein)