PIWIL2 Antikörper

Produktnummer ABIN630850

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PIWIL2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für PIWIL2 Antikörper (ABIN630850)

Target: PIWIL2 (Piwi-Like 2 (PIWIL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIWIL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PIWIL2 Antikörper

Aufreinigung: Affinity purified

Immunogen: PIWIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIWIL2 Blocking Peptide, (ABIN5615388), is also available for use as a blocking control in assays to test for specificity of this PIWIL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIWIL2

Target: PIWIL2 (Piwi-Like 2 (PIWIL2))

Andere Bezeichnung: PIWIL2

Hintergrund: PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

Molekulargewicht: 110 kDa (MW of target protein)

Pathways: Stem Cell Maintenance