FLII Antikörper

Produktnummer ABIN630840

Dieses Anti-FLII-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FLII in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für FLII Antikörper (ABIN630840)

Target: FLII (Flightless I Homolog (FLII))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FLII Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FLII Antikörper

Aufreinigung: Affinity purified

Immunogen: FLII antibody was raised using a synthetic peptide corresponding to a region with amino acids LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLII Blocking Peptide, (ABIN940147), is also available for use as a blocking control in assays to test for specificity of this FLII antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLII antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FLII

Target: FLII (Flightless I Homolog (FLII))

Andere Bezeichnung: FLII

Hintergrund: FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Molekulargewicht: 145 kDa (MW of target protein)