MPDZ Antikörper (Middle Region)

Produktnummer ABIN630839

Produktdetails anti-MPDZ Antikörper

Target: MPDZ (Multiple PDZ Domain Protein (MPDZ))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPDZ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MPDZ antibody was raised against the middle region of MPDZ

Aufreinigung: Affinity purified

Immunogen: MPDZ antibody was raised using the middle region of MPDZ corresponding to a region with amino acids DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPDZ Blocking Peptide, catalog no. 33R-1891, is also available for use as a blocking control in assays to test for specificity of this MPDZ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPDZ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPDZ

Target: MPDZ (Multiple PDZ Domain Protein (MPDZ))

Andere Bezeichnung: MPDZ (MPDZ Produkte)

Synonyme: HYC2 antikoerper, MUPP1 antikoerper, AI225843 antikoerper, B930003D11Rik antikoerper, multiple PDZ domain crumbs cell polarity complex component antikoerper, multiple PDZ domain protein antikoerper, Multiple PDZ domain protein antikoerper, inactivation-no-after-potential D protein antikoerper, multiple pdz domain protein, putative antikoerper, MPDZ antikoerper, Mpdz antikoerper, mpz-1 antikoerper, LOC5569990 antikoerper, Smp_168960 antikoerper

Hintergrund: MPDZ Interacts with HTR2C and provokes its clustering at the cell surface (By similarity). It is a member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses.

Molekulargewicht: 218 kDa (MW of target protein)

Pathways: Synaptic Membrane, Phototransduction