MPDZ Antikörper (Middle Region)
-
- Target Alle MPDZ Antikörper anzeigen
- MPDZ (Multiple PDZ Domain Protein (MPDZ))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MPDZ Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MPDZ antibody was raised against the middle region of MPDZ
- Aufreinigung
- Affinity purified
- Immunogen
- MPDZ antibody was raised using the middle region of MPDZ corresponding to a region with amino acids DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI
- Top Product
- Discover our top product MPDZ Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MPDZ Blocking Peptide, catalog no. 33R-1891, is also available for use as a blocking control in assays to test for specificity of this MPDZ antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPDZ antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPDZ (Multiple PDZ Domain Protein (MPDZ))
- Andere Bezeichnung
- MPDZ (MPDZ Produkte)
- Synonyme
- HYC2 antikoerper, MUPP1 antikoerper, AI225843 antikoerper, B930003D11Rik antikoerper, multiple PDZ domain crumbs cell polarity complex component antikoerper, multiple PDZ domain protein antikoerper, Multiple PDZ domain protein antikoerper, inactivation-no-after-potential D protein antikoerper, multiple pdz domain protein, putative antikoerper, MPDZ antikoerper, Mpdz antikoerper, mpz-1 antikoerper, LOC5569990 antikoerper, Smp_168960 antikoerper
- Hintergrund
- MPDZ Interacts with HTR2C and provokes its clustering at the cell surface (By similarity). It is a member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses.
- Molekulargewicht
- 218 kDa (MW of target protein)
- Pathways
- Synaptic Membrane, Phototransduction
-