MPDZ Antikörper (Middle Region)

Produktnummer ABIN630839

Der Kaninchen Polyklonal Anti-MPDZ-Antikörper wurde für WB validiert. Er ist geeignet, MPDZ in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für MPDZ Antikörper (Middle Region) (ABIN630839)

Target: MPDZ (Multiple PDZ Domain Protein (MPDZ))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPDZ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MPDZ Antikörper

Bindungsspezifität: Middle Region

Spezifität: MPDZ antibody was raised against the middle region of MPDZ

Aufreinigung: Affinity purified

Immunogen: MPDZ antibody was raised using the middle region of MPDZ corresponding to a region with amino acids DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPDZ Blocking Peptide, (ABIN937277), is also available for use as a blocking control in assays to test for specificity of this MPDZ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPDZ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPDZ

Target: MPDZ (Multiple PDZ Domain Protein (MPDZ))

Andere Bezeichnung: MPDZ

Hintergrund: MPDZ Interacts with HTR2C and provokes its clustering at the cell surface (By similarity). It is a member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses.

Molekulargewicht: 218 kDa (MW of target protein)

Pathways: Synaptic Membrane, Phototransduction