Transglutaminase 5 Antikörper (C-Term)

Produktnummer ABIN630837

Der Kaninchen Polyklonal anti-Transglutaminase 5 Antikörper (ABIN630837) detektiert spezifisch Transglutaminase 5 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für Transglutaminase 5 Antikörper (C-Term) (ABIN630837)

Target: Transglutaminase 5 (TGM5)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Transglutaminase 5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Transglutaminase 5 Antikörper

Bindungsspezifität: C-Term

Spezifität: Transglutaminase 5 antibody was raised against the C terminal of TGM5

Aufreinigung: Affinity purified

Immunogen: Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Transglutaminase 5 Blocking Peptide, (ABIN5616760), is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Transglutaminase 5

Target: Transglutaminase 5 (TGM5)

Andere Bezeichnung: Transglutaminase 5

Hintergrund: TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS).

Molekulargewicht: 81 kDa (MW of target protein)