ACTN2 Antikörper (N-Term)
-
- Target Alle ACTN2 Antikörper anzeigen
- ACTN2 (Actinin, alpha 2 (ACTN2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACTN2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Alpha Actinin 2 antibody was raised against the N terminal of ACTN2
- Aufreinigung
- Affinity purified
- Immunogen
- alpha Actinin 2 antibody was raised using the N terminal of ACTN2 corresponding to a region with amino acids NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH
- Top Product
- Discover our top product ACTN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Alpha Actinin 2 Blocking Peptide, catalog no. 33R-6838, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTN2 (Actinin, alpha 2 (ACTN2))
- Andere Bezeichnung
- alpha Actinin 2 (ACTN2 Produkte)
- Synonyme
- MGC89234 antikoerper, ACTN2 antikoerper, 1110008F24Rik antikoerper, CMD1AA antikoerper, wu:fd44c03 antikoerper, zgc:123223 antikoerper, actinin alpha 2 antikoerper, actinin, alpha 2b antikoerper, actinin alpha 2 S homeolog antikoerper, actn2 antikoerper, ACTN2 antikoerper, Actn2 antikoerper, actn2b antikoerper, actn2.S antikoerper
- Hintergrund
- The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres.
- Molekulargewicht
- 104 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Skeletal Muscle Fiber Development, Negative Regulation of Transporter Activity
-