ACTN2 Antikörper (N-Term)

Produktnummer ABIN630832

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ACTN2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ACTN2 Antikörper (N-Term) (ABIN630832)

Target: ACTN2 (Actinin, alpha 2 (ACTN2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACTN2 Antikörper

Bindungsspezifität: N-Term

Spezifität: Alpha Actinin 2 antibody was raised against the N terminal of ACTN2

Aufreinigung: Affinity purified

Immunogen: alpha Actinin 2 antibody was raised using the N terminal of ACTN2 corresponding to a region with amino acids NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Alpha Actinin 2 Blocking Peptide, (ABIN5612031), is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTN2

Target: ACTN2 (Actinin, alpha 2 (ACTN2))

Andere Bezeichnung: alpha Actinin 2

Hintergrund: The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres.

Molekulargewicht: 104 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Skeletal Muscle Fiber Development, Negative Regulation of Transporter Activity