Copine IV Antikörper (C-Term)

Produktnummer ABIN630831

Produktdetails anti-Copine IV Antikörper

Target: Copine IV (CPNE4)

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Copine IV Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Copine IV antibody was raised against the C terminal of CPNE4

Aufreinigung: Affinity purified

Immunogen: Copine IV antibody was raised using the C terminal of CPNE4 corresponding to a region with amino acids EAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Copine IV Blocking Peptide, catalog no. 33R-2291, is also available for use as a blocking control in assays to test for specificity of this Copine IV antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Copine IV

Target: Copine IV (CPNE4)

Andere Bezeichnung: Copine IV (CPNE4 Produkte)

Synonyme: CPNE4 antikoerper, COPN4 antikoerper, CPN4 antikoerper, 3632411M23Rik antikoerper, 4933406O10Rik antikoerper, si:dkey-5n4.1 antikoerper, copine 4 antikoerper, copine IV antikoerper, copine IVb antikoerper, CPNE4 antikoerper, cpne4 antikoerper, Cpne4 antikoerper, cpne4b antikoerper

Hintergrund: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.

Molekulargewicht: 62 kDa (MW of target protein)