Copine IV Antikörper (C-Term)

Produktnummer ABIN630831

Dieses Anti-Copine IV-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Copine IV in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für Copine IV Antikörper (C-Term) (ABIN630831)

Target: Copine IV (CPNE4)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Copine IV Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Copine IV Antikörper

Bindungsspezifität: C-Term

Spezifität: Copine IV antibody was raised against the C terminal of CPNE4

Aufreinigung: Affinity purified

Immunogen: Copine IV antibody was raised using the C terminal of CPNE4 corresponding to a region with amino acids EAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Copine IV Blocking Peptide, (ABIN937677), is also available for use as a blocking control in assays to test for specificity of this Copine IV antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Copine IV

Target: Copine IV (CPNE4)

Andere Bezeichnung: Copine IV

Hintergrund: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.

Molekulargewicht: 62 kDa (MW of target protein)