LIAS Antikörper (N-Term)
Kurzübersicht für LIAS Antikörper (N-Term) (ABIN630827)
Target
Alle LIAS Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- LIAS antibody was raised against the N terminal of LIAS
-
Aufreinigung
- Affinity purified
-
Immunogen
- LIAS antibody was raised using the N terminal of LIAS corresponding to a region with amino acids LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
LIAS Blocking Peptide, (ABIN5614453), is also available for use as a blocking control in assays to test for specificity of this LIAS antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIAS antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- LIAS (Lipoic Acid Synthetase (LIAS))
-
Andere Bezeichnung
- LIAS
-
Hintergrund
- LIAS belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis.
-
Molekulargewicht
- 39 kDa (MW of target protein)
-
Pathways
- Tube Formation
Target
-