Peroxiredoxin 1 Antikörper (N-Term)

Produktnummer ABIN630826

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Peroxiredoxin 1 in WB. Er zeigt eine Reaktivität gegenüber Human und Ratte.

Kurzübersicht für Peroxiredoxin 1 Antikörper (N-Term) (ABIN630826)

Target: Peroxiredoxin 1 (PRDX1)

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Peroxiredoxin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Peroxiredoxin 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: PRDX1 antibody was raised against the N terminal of PRDX1

Aufreinigung: Affinity purified

Immunogen: PRDX1 antibody was raised using the N terminal of PRDX1 corresponding to a region with amino acids SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRDX1 Blocking Peptide, catalog no. 33R-8807, is also available for use as a blocking control in assays to test for specificity of this PRDX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Peroxiredoxin 1

Target: Peroxiredoxin 1 (PRDX1)

Andere Bezeichnung: PRDX1

Hintergrund: PRDX1 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: p53 Signalweg, EGFR Signaling Pathway, CXCR4-mediated Signaling Events