AKR1B1 Antikörper

Produktnummer ABIN630825

Produktdetails anti-AKR1B1 Antikörper

Target: AKR1B1 (Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKR1B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: AKR1 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AKR1B1 Blocking Peptide, catalog no. 33R-1528, is also available for use as a blocking control in assays to test for specificity of this AKR1B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AKR1B1

Target: AKR1B1 (Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1))

Andere Bezeichnung: AKR1B1 (AKR1B1 Produkte)

Synonyme: ADR antikoerper, ALDR1 antikoerper, ALR2 antikoerper, AR antikoerper, ALDRED antikoerper, ALR-P-I antikoerper, Akr1b3 antikoerper, Akr1b4 antikoerper, Aldr1 antikoerper, Alr antikoerper, RATALDRED antikoerper, akr1b7 antikoerper, zgc:86611 antikoerper, aldo-keto reductase family 1 member B antikoerper, aldo-keto reductase family 1, member B1 (aldose reductase) antikoerper, aldo-keto reductase family 1, member B1 (aldose reductase) S homeolog antikoerper, AKR1B1 antikoerper, Akr1b1 antikoerper, akr1b1.S antikoerper, akr1b1 antikoerper

Hintergrund: AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process