RNF44 Antikörper (N-Term)

Produktnummer ABIN630824

Der Kaninchen Polyklonal Anti-RNF44-Antikörper wurde für WB validiert. Er ist geeignet, RNF44 in Proben von Human zu detektieren.

Kurzübersicht für RNF44 Antikörper (N-Term) (ABIN630824)

Target: RNF44 (Ring Finger Protein 44 (RNF44))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF44 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RNF44 Antikörper

Bindungsspezifität: N-Term

Spezifität: RNF44 antibody was raised against the N terminal of RNF44

Aufreinigung: Affinity purified

Immunogen: RNF44 antibody was raised using the N terminal of RNF44 corresponding to a region with amino acids LSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF44 Blocking Peptide, (ABIN5615907), is also available for use as a blocking control in assays to test for specificity of this RNF44 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF44 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF44

Target: RNF44 (Ring Finger Protein 44 (RNF44))

Andere Bezeichnung: RNF44

Hintergrund: The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Molekulargewicht: 48 kDa (MW of target protein)