RNF44 Antikörper (N-Term)
-
- Target Alle RNF44 Antikörper anzeigen
- RNF44 (Ring Finger Protein 44 (RNF44))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNF44 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RNF44 antibody was raised against the N terminal of RNF44
- Aufreinigung
- Affinity purified
- Immunogen
- RNF44 antibody was raised using the N terminal of RNF44 corresponding to a region with amino acids LSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNF44 Blocking Peptide, catalog no. 33R-5467, is also available for use as a blocking control in assays to test for specificity of this RNF44 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF44 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF44 (Ring Finger Protein 44 (RNF44))
- Andere Bezeichnung
- RNF44 (RNF44 Produkte)
- Hintergrund
- The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.
- Molekulargewicht
- 48 kDa (MW of target protein)
-