MATN2 Antikörper (Middle Region)

Produktnummer ABIN630823

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MATN2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für MATN2 Antikörper (Middle Region) (ABIN630823)

Target: MATN2 (Matrilin 2 (MATN2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MATN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MATN2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Matrilin 2 antibody was raised against the middle region of MATN2

Aufreinigung: Affinity purified

Immunogen: Matrilin 2 antibody was raised using the middle region of MATN2 corresponding to a region with amino acids AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Matrilin 2 Blocking Peptide, (ABIN936984), is also available for use as a blocking control in assays to test for specificity of this Matrilin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MATN2

Target: MATN2 (Matrilin 2 (MATN2))

Andere Bezeichnung: Matrilin 2

Hintergrund: MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.

Molekulargewicht: 102 kDa (MW of target protein)