Myoglobin Antikörper (N-Term)

Produktnummer ABIN630815

Produktdetails anti-Myoglobin Antikörper

Target: Myoglobin (MB)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Myoglobin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Myoglobin antibody was raised against the N terminal of MB

Aufreinigung: Affinity purified

Immunogen: Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Myoglobin Blocking Peptide, catalog no. 33R-6045, is also available for use as a blocking control in assays to test for specificity of this Myoglobin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MB antibody in PBS

Konzentration: Lot specific

Buffer: PBS, 0.09% sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-Myoglobin Antikörper (ABIN630815)

Bell, Wilding, Funke, Perumal, Beck, Wolters, Holz-Müller, Pfeiffer, Grus: "Neuroprotective effects of antibodies on retinal ganglion cells in an adolescent retina organ culture." in: Journal of neurochemistry, Vol. 139, Issue 2, pp. 256-269, (2016) (PubMed).

Details zu Myoglobin

Target: Myoglobin (MB)

Andere Bezeichnung: Myoglobin (MB Produkte)

Synonyme: PVALB antikoerper, AI325109 antikoerper, zgc:65819 antikoerper, zgc:77764 antikoerper, MB antikoerper, DKFZp468H096 antikoerper, myg antikoerper, mb antikoerper, MYF4 antikoerper, bHLHc3 antikoerper, myo antikoerper, Myoglobin antikoerper, myoglobin antikoerper, myogenin antikoerper, MB antikoerper, Mb antikoerper, mb antikoerper, myg antikoerper, Myog antikoerper

Hintergrund: This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation