Myoglobin Antikörper (N-Term)

Produktnummer ABIN630815

Der Kaninchen Polyklonal Anti-Myoglobin-Antikörper wurde für WB validiert. Er ist geeignet, Myoglobin in Proben von Human zu detektieren. Es ist 1 Publikation verfügbar.

Kurzübersicht für Myoglobin Antikörper (N-Term) (ABIN630815)

Target: Myoglobin (MB)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Myoglobin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Myoglobin Antikörper

Bindungsspezifität: N-Term

Spezifität: Myoglobin antibody was raised against the N terminal of MB

Aufreinigung: Affinity purified

Immunogen: Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Myoglobin Blocking Peptide, (ABIN5614898), is also available for use as a blocking control in assays to test for specificity of this Myoglobin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MB antibody in PBS

Konzentration: Lot specific

Buffer: PBS, 0.09% sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-Myoglobin Antikörper (ABIN630815)

Bell, Wilding, Funke, Perumal, Beck, Wolters, Holz-Müller, Pfeiffer, Grus: "Neuroprotective effects of antibodies on retinal ganglion cells in an adolescent retina organ culture." in: Journal of neurochemistry, Vol. 139, Issue 2, pp. 256-269, (2016) (PubMed).

Details zu Myoglobin

Target: Myoglobin (MB)

Andere Bezeichnung: Myoglobin

Hintergrund: This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation