LGALS8 Antikörper
-
- Target Alle LGALS8 Antikörper anzeigen
- LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LGALS8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- LGALS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD
- Top Product
- Discover our top product LGALS8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LGALS8 Blocking Peptide, catalog no. 33R-3014, is also available for use as a blocking control in assays to test for specificity of this LGALS8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))
- Andere Bezeichnung
- LGALS8 (LGALS8 Produkte)
- Synonyme
- LGALS8 antikoerper, 1200015E08Rik antikoerper, AI326142 antikoerper, D13Ertd524e antikoerper, Lgals-8 antikoerper, galectin-8 antikoerper, Gal-8 antikoerper, PCTA-1 antikoerper, PCTA1 antikoerper, Po66-CBP antikoerper, xgalectin-VIIIa antikoerper, galectin 8 antikoerper, lectin, galactose binding, soluble 8 antikoerper, lectin, galactoside binding soluble 8 S homeolog antikoerper, LGALS8 antikoerper, Lgals8 antikoerper, lgals8.S antikoerper
- Hintergrund
- LGALS8 is a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions.
- Molekulargewicht
- 39 kDa (MW of target protein)
-